FLJ22167 (N-Term) antibody

Catalog No. ABIN630360

This anti- antibody is a Rabbit Polyclonal antibody detecting in WB and IHC. Suitable for Human and Dog.

Quick Overview for FLJ22167 (N-Term) antibody (ABIN630360)

Target: FLJ22167

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details

Binding Specificity: N-Term

Specificity: FLJ22167 antibody was raised against the N terminal of FLJ22167

Purification: Purified

Immunogen: FLJ22167 antibody was raised using the N terminal of FLJ22167 corresponding to a region with amino acids CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLJ22167 Blocking Peptide, (ABIN937093), is also available for use as a blocking control in assays to test for specificity of this FLJ22167 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ22167 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: FLJ22167

Background: The FLJ22167 protein catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues and O-linked sugars of mucin-type acceptors. FLJ22167 acts on the non-reducing terminal GlcNAc of short carbohydrate substrates.

Molecular Weight: 36 kDa (MW of target protein)